TCT -Alcatel Move FRG83G custom ROM

do you have an Alcatel OT-908 phone ?

  • yes

    Votes: 89 58.2%
  • no

    Votes: 36 23.5%
  • OT-908 F/S/A

    Votes: 34 22.2%

  • Total voters
    153
Search This thread

ruscan.calin

Senior Member
Nov 29, 2010
622
289
!? in menu application called PHONE...
with phone dialer, call log, contacts ,favorites..


themes on market are only for launchers look! settings, status bar ... and whole look of ROM must be changed with diferent pngs

let me guess you set an order here ? if then will cost you exactly 50 buc:Dks
will take a lot of time to customize all things there and this is not my purpose
I intend to make a rom who is
1.clean
2.stable/ fast
3.enhanced in funtionality

I will change some things about look but not all because there is a lot of work and I'm not sure will meet users requirements by ex some people say they want black status bar some original/ stock status bar etc
It is up to you to change someway these things although there not to many tools for this phone
themes are for HTC etc
You have to understand this is not a well-known phone so less tools to customize
also I think phone.apk is ok I like it what to change there ?
I think you should read some papers before ask these things

PS a phone is not like a car:D
 
Last edited:
  • Like
Reactions: bidulç&

bidulç&

Member
Feb 5, 2008
9
2
Hello,
your job is very interesting, I have a OT-908f from orange france and it restart randomly when I use heavy app like sygic or Orange cinema Series app.
So I'm very interesting for your job.
But it seems that users from russia managed to obtain a official 2.3.4 rom from alcatel:
http://alcatel-fun.ru/news/vyshlo_o...29-131&usg=ALkJrhjR9WS4L56zwOBqcHLtwi0Zzt42hQ

So shall we expect a custom ROM in 2.3.4 for our OT-908 devices?

Thank you.
 
Last edited:
  • Like
Reactions: ruscan.calin

ruscan.calin

Senior Member
Nov 29, 2010
622
289
Hello,
your job is very interesting, I have a OT-908f from orange france and it restart randomly when I use heavy app like sygic or Orange cinema Series app.
So I'm very interesting for your job.
But it seems that users from russia managed to obtain a official 2.3.4 rom from alcatel:
http://alcatel-fun.ru/news/vyshlo_o...29-131&usg=ALkJrhjR9WS4L56zwOBqcHLtwi0Zzt42hQ

So shall we expect a custom ROM in 2.3.4 for our OT-908 devices?

Thank you.

yes but this is on alcatel-fun site so what is that about ? a joke I think
also I do not know how to enter service menu there should be an option to change region code - to Russia so to get updated (??)with 2.3.4 by fool:Dish update server to think you are in Russia
only jokes I think will stay a long time on 2.2.2...
 

ruscan.calin

Senior Member
Nov 29, 2010
622
289
mod update

write this patch/update by CWM
before wipe cache/Dalvik-cache just in case...
will take a while at first startup for system to reconstruct Dalvik-cache
I will complete this post soon ... how to change clock font to white and remaining gray buttons

what is new

-changed bootanimation so system starts up faster and get +2M space:D
-themed status bar
-changed system fonts etc

hope will appreciate or not :confused::D
 
Last edited:

marinalin85

Senior Member
Jan 22, 2012
451
1,040
30
Moldova Noua
write this patch/update by CWM
before wipe cache/Dalvik-cache just in case...
will take a while at first startup for system to reconstruct Dalvik-cache
I will complete this post soon ... how to change clock font to white and remaining gray buttons

what is new

-changed bootanimation so system starts up faster and get +2M space:D
-themed status bar
-changed system fonts etc

hope will appreciate or not :confused::D
Maybe some screenshot, with that theme for status bar? :D
 
  • Like
Reactions: ruscan.calin

duducordos

Member
Jul 23, 2008
7
1
Hi!
Some questions too:
seems i canot put CWM on my phone (908F).
The button sequence for my phone to enter fastboot or CWM seems to be different; wich one is my "Menu" button that i have to push topgether with volume up or down? is it the "F" button?

a step by step guide for dumbs like me would be gr8!

Thanks!
 
  • Like
Reactions: ruscan.calin

ruscan.calin

Senior Member
Nov 29, 2010
622
289
Hi!
Some questions too:
seems i canot put CWM on my phone (908F).
The button sequence for my phone to enter fastboot or CWM seems to be different; wich one is my "Menu" button that i have to push topgether with volume up or down? is it the "F" button?

a step by step guide for dumbs like me would be gr8!

Thanks!

Hey what is that dumb :confused: I know only about people who want to know!

fastboot is a way to make a lot of things by ex to write CWM to phone will work even if phone is not rooted to enter fastboot turn off phone then press Power Button until buzz then quickly Vol Down + Home (maybe you have "f" on phone think about the biggest button on you phone) for about 10-15s then release buttons now there is nothing on screen but you are entering fastboot mode
now it's time to connect phone to PC so can write CWM but you need fastboot executable on PC

will be continued...
 
Last edited:
  • Like
Reactions: duducordos

ruscan.calin

Senior Member
Nov 29, 2010
622
289
I 'am not sure it is a joke : http://4pda.ru/forum/index.php?showtopic=280998&st=440
but the gingerbread version seems to be buggy

single useful thing from that forum is *#*#4636#*#* but this is not code for engineering/service menu..
I don't believe they have 2.3 but promise to make a custom rom if this 2.3 update will be here
I think 2.3 is in some kind of zombie status :eek:

for OT-990 no 2.3 update and this is BIG:eek: phone not like 908:D
look here how they managed to add 2.3 to this phone but I think that is...it
 
Last edited:

duducordos

Member
Jul 23, 2008
7
1
Thanks for the fast answer / help!
Indeed it seems i managed to instal CWM form fastboot but i was just unable to enter its menu; i was pressing all 3 buttons at once, or just two of them but not the required two; finally your post made explicit for me to FIRST power up THEN quickly press vol+ and biiig blue F button; after that installing new ROM was piece of cake, it's on the phone and working great so far!

Many thanks (moving from windows mobile to android for the 1st time...)
 

ruscan.calin

Senior Member
Nov 29, 2010
622
289
how to change status bar

I suggest to flash update.zip from post #44 to see differences
if you don't like that just see picture below
create /temp folder anywhere extract zip content here

1. change clock color from black to white -because status bar background is already black

requires services.jar from phone to get on PC enter command line
firstly check that phone is connected to PC by
adb devices
List of devices attached
xxxxxxxxxxxxx device

if not something is not ok usb drivers/sdk/USB debugging-active

now to get services.jar enter this
adb pull /system/framework/services.jar services.jar
copy this file from adb folder to a temp folder somewhere
extract from services.jar classes.dex file
important I use 7.zip but don't extract all files in jar archive only classes.dex leave archive as it is
I mean packed because extracting as usual will result in losing package signature so it have to be signed pack -yes this is possible to sign again
open command line in /temp folder and enter
java -Xmx512M -jar baksmali.jar -o classout classes.dex
there will be a folder named classout navigate to
com/android/server/status and see StatusBarIcon.smali
open in editor I use Notepad++
search for const/high16 v6, -0x100 and replace by const v6, -0x1
save and close file in the same /temp folder
now insert command to pack back classes.dex
java -Xmx512M -jar smali.jar classout -o classes.dex
add new classes.dex to services.jar by same way you extracted
now write back to phone services.jar file
adb push services.jar /system/framework/services.jar
adb restart and see results now clock has white color

2.changing colors to buttons on status bar

need framework-res.apk to get from phone use
adb pull /system/framework/framework-res.apk framework-res.apk
check for these files in apk archive - do not extract archive only these files located in /res/drawable-ldpi

status_bar_switch_apps_bluetooth_half.png
status_bar_switch_apps_bluetooth_off.png
status_bar_switch_apps_bluetooth_on.png
status_bar_switch_apps_gps_off.png
status_bar_switch_apps_gps_on.png
status_bar_switch_apps_plane_off.png
status_bar_switch_apps_plane_on.png
status_bar_switch_apps_volume_mute.png
status_bar_switch_apps_volume_normal.png
status_bar_switch_apps_wifi_off.png
status_bar_switch_apps_wifi_on.png
switcher_plate.png

extract to /temp folder then use any editor to modify as you wish but keep the same name/extension or get from attachment modified files and copy to apk archive back
now it is time to put on phone modified framework file- this is very important to Android interface corrupted file results in infinite loopback -phone will not pass from bootanimation so take care!
adb push framework-res.apk /system/framework/framework-res.apk
adb reboot


also I'm changing text color for notifications to white and update
this is status bar of next version for custom ROM
 

Attachments

  • screenshot_0427192420.png
    screenshot_0427192420.png
    27.9 KB · Views: 148
  • smali.zip
    2.2 MB · Views: 36
  • status.bar.zip
    13.2 KB · Views: 40
Last edited:
  • Like
Reactions: marinalin85

ruscan.calin

Senior Member
Nov 29, 2010
622
289
browser homepage

how I changed browser homepage to google.com

for this phone browser homepage is set in browser-res.apk file
get from attach open in any hex editor search for m.origo.hu- default homepage in this case
replace 6D 2E 6F 72 69 67 6F 2E 68 75
with this 67 6F 6F 67 6C 65 2E 63 6F 6D
save and close now homepage is set to google.com this is the way I changed default homepage in browser

PS will not work on any phone model
 

Attachments

  • Capture.JPG
    Capture.JPG
    219.2 KB · Views: 83
  • Browser-res.zip
    303 KB · Views: 21
Last edited:

milireno

Member
Apr 23, 2012
9
4
Thanks :) for your tutos ,and update ...

Question:
-when you make your update ,did you signed it ,and how ?
-do you know where is the default wallpaper ,because I would like to replace by a live wallpaper?
-do you know a method to open file .img ,like boot.img ?

for OT-990 no 2.3 update and this is BIG phone not like 908

In forum.hardware.fr ,in french ,they put 2.3.4 in OT990,so may be ,one day,in 908....;)
 
Last edited:

ruscan.calin

Senior Member
Nov 29, 2010
622
289
benchmarking

I tested in Quadrant 2.0 Standard Edition
As someone can see custom ROM is faster than stock ROM
I tested this final custom ROM finally released today compared to stock ROM T-Mobile Hu
+10 % points but this version is not optimized for performance yet
next version is focused on system improvements
for me it's enough to have 150 MB free and a lot of functionality

Hey!!
TEST your stock ROM Cosmote/Globul/T-Mobile or whatever and POST to compare between them!!
BUT use only Quadrant 2.0 Standard from Market not 1.0 so we can compare to each other
 

Attachments

  • 2012.04.28-04.45.20.jpg
    2012.04.28-04.45.20.jpg
    53.6 KB · Views: 100
  • 2012.04.28-11.17.11.jpg
    2012.04.28-11.17.11.jpg
    55.7 KB · Views: 86
Last edited:
  • Like
Reactions: milireno

ruscan.calin

Senior Member
Nov 29, 2010
622
289
Great !!

I have found some responses from your post about TCT-Alcate Move ...

sorry ...I'm reading now to try answering ..I was a little busy with my previous post:D
as I see you found some answers so tell me how can help also if you have link to French forum post it
to see it
anyway default_wallpaper resides in /custpack/framework/framework-res.apk in /res/drawable
but you can not change this by live wallpaper for this install an app from Market
live wallpaper consists of some images and a script to animate them
wallpaper is a simple image file
 
Last edited:

leonhot

New member
Dec 28, 2010
3
1
Hello.
I would really like to try your Rom out. I have been trying for the past 14 hrs and I get the same message "The user hosting this
content is out of bandwidth."
Great job though. The Phone is great but the bugs in the official rom make it unfriendly.
Keep up the great work.
OT-908S
 
Last edited:
  • Like
Reactions: ruscan.calin

ruscan.calin

Senior Member
Nov 29, 2010
622
289
to marinalin85 or how to check ADB interface is working in Windows

HERE is original USB/ ADB interface driver or install Android Manager & One Touch Upgrade from HERE
 

Attachments

  • Capture.JPG
    Capture.JPG
    96.5 KB · Views: 96
Last edited:
  • Like
Reactions: marinalin85

milireno

Member
Apr 23, 2012
9
4
Hi,

Hey!!
TEST your stock ROM Cosmote/Globul/T-Mobile or whatever and POST to compare between them!!
BUT use only Quadrant 2.0 Standard from Market

I try running QUADRANT ,but the screen is small,I can't push on the button :mad:
Help !!!:eek:
 

Attachments

  • ot908F.jpg
    ot908F.jpg
    22.4 KB · Views: 71
Last edited:

Top Liked Posts

  • There are no posts matching your filters.
  • 24
    introducing first custom rom
    for alcatel ot-908 android 2.2


    [ disclaimer ]
    do not flash roms not intended
    to be made for your phone !
    these roms can damage your hardware !
    [ requirements ]
    • this custom rom will work for any alcatel ot-908 phone
      or branded one cosmote/globul/t-mobile/orange move
    • for OT908 s/f/a read post # 7 to solve sensor-keys problem
    • also must have cwm recovery installed
    • if neither phone is rooted nor you have cwm recovery then read post #7
    [ features ]

    • based on alcatel stock rom 2.2.2 android
    • zipaligned
    • removed stock apps- 0 bloatware
    • changed browser homepage (google.com)
    • updated market/ maps/ youtube
    • add busybox/ root explorer /terminal emulator/bash
    • removed stock-based/ add new splashscreen/ bootanimation/screen locker
    • replaced stock launcher /adw.launcher/ Regina
    • add root/ cwm recovery
    • add /data/app feature
    • add /etc/init.d scripting support
    • add a2sd - thanks to The Darktremor
    • moved dalvik-cache to get free space
    • improve gps accuracy
    • modded status bar
    • add reboot/recovery/fastboot to Power Menu
    • system tweaks
    • undervolting/ overclocking

    [ language support ]
    • English
    • Romanian
    • German
    • Spanish
    • French
    • Italian
    • Hungarian
    • Dutch
    • Turkish
    • Portuguese
    • Czech
    • Bulgarian
    • Polish
    • Slovak
    • Croatian
    if not on list read this

    [installation | download ]
    read post #136
    DOWNLOAD Move_v4.0 (September 11, 2012)
    -for OT908 SFA flash this ROM then read post #5 to change keys
    -to sync with Desktop you can use :

    Wondershare MobileGo (take screenshots)
    MyPhoneExplorer (you can control phone from PC)
    QtADB (advanced)
    5
    @yecarrillo I gave you a link to a CWM based on GB kernel compiled from sourceforge you can use it to backup phone partitions and if you share it I can prepare a custom rom with root and other things ....where are you ?

    well, I'm working with Cyanogenmod sources because I got another phone Huawei Sonic
    yes this phone is Cyanogenmod-enabled and this is great !

    first result is that I ported CWM 5.0.2.8 on this phone (908) so here is a new ver for CWM and I have control over the sources so this is great
    anyway there is a bug / missing feature because like old ver will not perform a full backup so I'm working to fix it !

    If you don't know CWM is very good it's first step to perpare a custom rom and now it's easy there is a port for this phone!
    on this phone something is missing from backup made by CWM : /custpack partition so I have to fix it!

    yes CWM sent to yecarrillo will do a full backup but I do not want to share it here because it's based on GB kernel and more it's adapted from another phone ...even if it works !

    if you do not know Clockworkmod recovery is official recovery for Cyanogenmod-enabled phones also there is a CWM builder here http://builder.clockworkmod.com/ but that's not working on this phone


    FRIENDS !!!

    update soon after 8 hours (at least :eek::D) I fixed it and more :It works ! now this phone has a FULL BACKUP !!
    no need to use Titanium or other backup tools and to prepare a custom rom (if GB is really here ) it's so easy...
    well I have a button-asserts problem I hope to fix it then I post here the last CWM 5.0.2.8 !
    5
    update

    well, allow me to introduce you ...

    CWM 5.0.2.8 here ! :cowboy:

    how to flash :

    -copy to sdcard
    -reboot recovery
    -flash CWM.5028.zip
    -remove/ insert battery (optional)
    -reboot recovery VOLUP+menu

    how to test :

    -well do a backup
    - reboot and delete something especially from /custpack
    -reboot recovery and restore your backup
    -restart and check it

    NOTE

    datadata.img ------> custpack partition


    here is recovery 5.0.2.8 log :

    Code:
    Starting recovery on Sun Sep  2 18:22:32 2012
    framebuffer: fd 4 (240 x 320)
    CWM-based Recovery v5.0.2.8
    recovery filesystem table
    =========================
      0 /tmp ramdisk (null) (null)
      1 /boot mtd boot (null)
      2 /cache yaffs2 cache (null)
      3 /data yaffs2 userdata (null)
      4 /misc mtd misc (null)
      5 /recovery mtd recovery (null)
      6 /sdcard vfat /dev/block/mmcblk0p1 /dev/block/mmcblk0
      7 /system yaffs2 system (null)
      8 /datadata yaffs2 custpack (null)
      9 /sd-ext auto /dev/block/mmcblk0p2 (null)
    
    W:Unable to get recovery.fstab info for /emmc during fstab generation!
    I:Completed outputting fstab.
    I:Processing arguments.
    I:Boot status: OKAY
    I:Got arguments from boot message
    mtd: successfully wrote block at fffffd5800000000
    I:Set boot command "boot-recovery"
    I:Checking arguments.
    I:device_recovery_start()
    Command: "recovery"
    
    ro.secure=0
    ro.allow.mock.location=0
    ro.debuggable=1
    persist.service.adb.enable=1
    ro.modversion=CWM-5.0.2.8
    ro.product.device=ot908
    ro.product.name=ot908
    usb.default.pid=0x9018
    persist.usb.default.pid=0x9018
    ro.build.date=Sun Sep 02 21:02:00 PST 2012
    ro.build.owner=ruscan.calin
    ro.factorytest=0
    ro.serialno=
    ro.bootmode=unknown
    ro.baseband=unknown
    ro.carrier=unknown
    ro.bootloader=LY66Z0Z0
    ro.hardware=qcom
    ro.revision=0
    ro.emmc=0
    init.svc.recovery=running
    init.svc.adbd=running
    
    I:Checking for extendedcommand...
    I:Skipping execution of extendedcommand, file not found...
    mtd: successfully wrote block at fffffd5800000000
    I:Set boot command ""
    SD Card space free: 1297MB
    [B][B]Backing up boot image...
    Backing up recovery image...
    Backing up system...[/B][/B]
    liblibdsutils.solibz.sovariance.solibOmxAmrDec.solibopencore_rtsp.solibreference-ril.solibmediaplayerservice.solibloc_ext.solibdrmagent_wrapper.solibbluedroid.solibsysutils.solibdl.socorgi.solibOmxQcelp13Enc.solibdvm.solibOmxAmrEnc.solibFFTEm.solibril-qc-1.soliblog.solibhzrecog-jni.solibbluetooth.solibcamera_client.solibthread_db.solibHmAgent.sodejitter.solibomx_sharedlibrary.solibwmsts.solibemoji.solibOmxAmrRtpDec.solibsnd.solibril-qcril-hook-oem.solibping_mdm.solibOmxWmvDec.solibui.solibqmi.soinputraw.solibmmgsdilib.solibjni_pinyinime.solibsqlite.solibopencore_download.solibjrdrapijni.solibpdapi.solibcrypto.solibaudio.solibmver_jni.solibgsdi_exp.solibaudioflinger.solibinbidi.solibvorbisidec.solibstagefright_omx.solibdbus.solibOmxH264Dec.solibstlport.solibacc.soliboem_rapi.solibwifitestmodejni.solibsig.soeglegl.cfglibEGL_adreno200.solibGLES_android.solibGLESv1_CM_adreno200.solibGLESv2_adreno200.solibq3dtools_adreno200.solibdrmagent.solibopencore_rtspreg.solibmm-abl.solibdsm.solibnetmgr.soliboncrpc.solinear.solibicudata.solibcameraservice.solibOmxAacDec.solibdll.solibexif.solibGLESv1_CM.solibRS.solibuim.solibqueue.solibwpa_client.solibOmxAmrwbDec.solibpixelflinger.solibsrec_jni.solibopencore_downloadreg.solibloc-rpc.solibEGL.sohwcopybit.msm7k.sogralloc.default.sogralloc.msm7k.solights.msm7k.sosensors.msm7k.solibril.solibjnigraphics.solibmvs.solibgsl.solibaudiopolicy.solibpdsm_atl.solibopencore_net_support.solibmedia.solibaudioalsa.solibdiag.solibOmxMp3Dec.solibsurfaceflinger.solibiprouteutil.solibhardware_legacy.solibc.solibstagefrighthw.solibwiperjni.solibskia.solibandroid_runtime.solibOmxVidEnc.solibttspico.soliboemcamera.solibopencorehw.solibmm-adspsvc.solibstagefright_avc_common.solibsonivox.solibopencore_author.solibdrmagent_jni.solibicui18n.solibcm.sobluez-pluginaudio.soinput.solibnetutils.solibmmipl.solibexpat.solibSR_AudioIn.solibutils.solibdrm1.solibctest.solibOmxCore.solibssl.solibopencore_mp4local.solibdsprofile.solibxml2wbxml.solibwbxml_jni.solibrpc.solibnativehelper.solibgstk_exp.solibOmxAacEnc.solibETC1.solibopencore_player.solibmedia_jni.somodulesbcm4329.kolibra.kolibrasdioif.kolibdiskconfig.solibOmxMpeg4Dec.solibrefcne.solibping_apps.solibhwrfuncs-jni.solibcamera.solibGLESv2.solibwms.solibskiagl.solibloc.solibjni_latinime.solibOmxWmaDec.solibttssynthproxy.solibqcomm_omx.solibpbmlib.solibmm-omxcore.solibauth.solibandroid_servers.solibsoundpool.solibopencore_common.solibjpeg.solibicuuc.solibcommondefs.solibsurfaceflinger_client.solibmmjpeg.solibgps.solibaudioeq.soliba2dp.solibvoicesearch.solibm.solibnv.solibcutils.solibOmxEvrcEnc.solibstdc++.solibstagefright.solibopencore_mp4localreg.solibdss.sopthres.solibbluetoothd.solibOmxAdpcmDec.solibdrm1_jni.solibreference-cdma-sms.solibloc_api.solibwebcore.solibbinder.solibrs_jni.solibsystem_server.solibnetlink.solibhardware.solibtslib.soappDrmProvider.apkTtsService.apkEmail.apkUserDictionaryProvider.apkHTMLViewer.apkVoiceDialer.apkJrdFmRadio.apkVpnServices.apkJrdLauncher.apkWiper.apkJrdSensor.apkcom.dolphin.browser-1.apkLatinIME.apkjackpal.androidterm-1.apkMMITestdev.apklauncher.apkMediaProvider.apkOPP.apkOTAProvisioningClient.apkPBAP.apkPackageInstaller.apkPhone.apkPicoTts.apkProtips.apkRegina_ToDo_0.5.5.apkAccountAndSyncSettings.apkRegina_Weather_0.7.3.apkApplicationsProvider.apkBluetoothServices.apkRoot-Explorer.apkCalendarProvider.apkSettings.apkCamera.apkSettingsProvider.apkCertInstaller.apkSoundRecorder.apkContactsProvider.apkStk.apkDefaultContainerService.apkSuperuser.apkDownloadProvider.apkTelephonyProvider.apkfontsbuild.propbinrun-asmm-abl-testbusybox.a2sddfmm-venc-omx-testmount.a2sd.swpschedtestmm-adec-omxaac-testchka2sdrenicemonkeygzip.launcha2sd.newsdptoolmm-adec-omxadpcm-testlsmoddmesgmtpdhandle_inter_RAT_handover.starta2sd.newservicemm-adec-omxamr-testcndrmmverproxyhandset-keypresslogdateshdalvikvmgeteventndchciattachservicemanagermm-adec-omxamrwb-testdbus-daemonrmdirchownwatchpropsCKPD-daemonsh0mm-adec-omxmp3-testdebuggerdgetpropnetcfgimePktRspTeststarta2sdcatumountrmmodnetdinputa2sdsumm-adec-omxwma-testdexopthdnetmgrdinstalldsyncpsmm-adspsvc-testdhcpcdroutenl_listeneriptablesadbfixsurfaceflingermm-aenc-omxaac-testdiag_klogidnotifyjita2sdakmd8975svcmm-aenc-omxamr-testdiag_mdlogschedtopnvcmdjrd_bcm4329_macamsysinitnetstatdnsmasqifconfigomx_testsmvapp_processsystem_servermm-aenc-omxevrc-testdtinstallsendeventpandjrd_rapiproxyapplypatchtcmm-aenc-omxqcelp13-testmkdiriftoppingjrdputapps2sd.hlptest_diagmm-audio-alsa-testdumpstatesetconsolepmkeystorelsddmm-audio-ctrl-testdumpsysinsmodport-bridgeklogd2audio_params_updatetoolboxmm-audio-mvs-testdvzsetpropcmpwipebashtune2fsmm-audio-native-teste2fsckioctlpppdlauncha2sdbattery_chargingvdcchmodvmstatsleepqmuxdlinkerbluetoothdvoldmm-jpeg-dec-testfill_eccnums_to_nvioniceracoonloc_api_apptoprebootmm-jpeg-enc-testfill_gsm_a5_to_nvsmdreadmtdlogcatbmgrwiperifacemm-qcamera-testfix_permissionskillprintenvlogwrapperbootanimationwmdsimm-qcamera-testsuite-clientfota_mainstartrildmediaserverbtldwpa_supplicantnewfs_msdosfotadlnrmt_storagenandreadbugreportzipalignmm-vdec-omx-testfsck_msdosstopframeworkcom.google.android.maps.jarcom.safenet.drmagent.jarcore.jarext.jarframework-tests.jarframework.jarime.jarinput.jarjavax.obex.jarmonkey.jarpm.jarservices.jarsvc.jarversionapi.jarframework-res.apkJrdshared.apkam.jarandroid.policy.jarandroid.test.runner.jarbmgr.jarusrkeychars7k_ffa_keypad.kcm.binqwerty.kcm.binqwerty2.kcm.binkeylayout7k_ffa_keypad.kl7k_handset.klAVRCP.klqwerty.klsrecconfigen.usgrammarsVoiceDialer.g2gboolean.g2gphone_type_choice.g2gmodelsgeneric.swiarbgeneric11.ldageneric11_f.swimdlgeneric11_m.swimdlgeneric8.ldageneric8_f.swimdlgeneric8_m.swimdlbaseline.parbaseline11k.parbaseline8k.pardictionarybasic.okcmu6plus.ok.zipenroll.okg2pen-US-ttp.datasharebmdRFFspeed_501.bmdRFFstd_501.bmdzoneinfozoneinfo.datzoneinfo.idxzoneinfo.versionwlanbroadcomnvram.txtfw_bcm4329.binfw_bcm4329_apsta.binmacaddrwpa_supplicant.confetcsecuritycacerts.bksotacerts.zipupdatecmdsgoogle_generic_update.txtvold.fstabwifi.conffirmwarewlancfg.datqcom_cfg.iniqcom_fw.binqcom_wlan_nv.binyamato_pfp.fwyamato_pm4.fwwifiwpa_supplicant.confgps.confwiperconfig.xmlhostsapns-conf.xmlwiper01_qcomm_omx.cfgAudioFilter.csvNOTICE.html.gzbluetoothblacklist.confinit.d00banner01sysctl02firstboot04apps2sd05mountsd99completedbus.confinit.goldfish.shinit.qcom.bt.shinit.qcom.coex.shinit.qcom.fm.shpermissionsandroid.hardware.camera.xmlandroid.hardware.location.xmlandroid.hardware.wifi.xmlcom.google.android.maps.xmlcom.safenet.drmagent.xmlhandheld_core_hardware.xmlplatform.xmlversionapi.xmlinit.qcom.post_boot.shinit.qcom.wifi.shpvplayer.cfgpppip-up-vpninit.qcom.wifitest.shrecovery.verdhcpcddhcpcd-hooks01-test20-dns.conf95-configureddhcpcd-run-hooksdhcpcd.confinit.qcom.wifitesttx.shresolv.confevent-log-tagsinit.qcom.wifitesttxn.shloc_parameter.inixbinkillall5dusortbusyboxhdttymtcatrdevlessechosplitsqlite3headttysizemvchattrreadaheadegreplnnameifhexdumptunctlstatchgrprealpathenvlognamenanddumphostidumountstringschmodreniceether-wakelosetupnandwritehostnameunamesttychownresetexpandlsnchttpduncompresssumchrootrevexprlsattrnetstathwclockunexpandswapoffchrtrfkillfakeidentdlsmodniceiduniqswaponcksumrmfdflushlsusbnmeterifconfigunix2dossyncclearrmdirfdformatlzopnslookupifenslaveunlzopsysctlcommrmmodfdisklzopcatntpdinetdunziptaccproutefgrepmd5sumodinotifyduptimetailcrondrun-partsfindmicrocompatchinsmodusleeptarcrontabscriptfoldteemkdirpgrepuudecodeinstallcutscriptreplayfreetelnetmkdosfssupidofuuencodeionicedatesedfreeramdisktelnetdmke2fs[pingvconfigiostatddseqfscktestmkfifo[[ping6viipdepmodsetkeycodesfsynctftpmkfs.ext2ashpkillwatchipaddrdevmemsetlogconsftpdtftpdmkfs.vfatawkpmapwcipcalcdfsetsidftpgettimemknodbase64powertopwgetiplinkdiffsha1sumftpputtimeoutmkswapbasenameprintenvwhichiproutedirnamesha256sumgetopttopmodinfoblkidprintfwhoipruledmesgsha512sumgreptouchmodprobebunzip2pswhoamiiptunneldnsdshowkeygroupstrmorebzcatpscanwhoiskilldnsdomainnamesleepa2sdgunziptraceroutemountbzip2pwdxargskillalldos2unixsmemcapapps2sdgziptreceroute6mountpointcalrdatezcatsystem.verts.conflost+found
    [B]Backing up data...[/B]
    custpack_app_flagtombstonestombstone_00wpstilesapp-privatedatacom.android.voicedialerlibfileslibdatabasesuser_dict.dbandroid.ttsliblibshared_prefspreferred-apn.xmldatabasesmmssms.dbtelephony.dbcom.noshufou.android.sulibcachedatabasespermissions.sqlitesu.dbshared_prefscom.android.stklibcom.zakus.wifiprofileslibfilesprofilesV2.bincom.android.soundrecorderliblibdatabasessettings.dbcom.alensw.PicFolderliblibqpicjni10.socom.android.settingslibfilescachewebviewCachedatabaseswebviewCache.dbwebview.dbshared_prefsapncheck.xmllibshared_prefsdatabasesexplorer.dbfileslibdatabasesweather.dbliblibdatabasestask.dbcom.android.protipslibcom.svox.picolibcom.android.phonelibfilesCallDurationCountdatabasessimiddb.dbshared_prefs_has_set_default_values.xmlcom.android.packageinstallerlibcom.broadcom.bt.appliblibdatabasesomaprovision.dbcom.wDroidLingoliblibcom.android.bluetoothlibcom.android.providers.mediadatabasesinternal.dbexternal-55bd0dcb.dblibcom.mmitestliblibjrdrapijni.socom.android.inputmethod.latindatabasesauto_dict.dbliblibjni_latinime.socom.linxmap.androidterminalcachewebviewCache27fa942fc2b4009ddb290e45liblibandroidterm.sodatabaseswebviewCache.dbwebview.dbshared_prefscom.jrdcom.JrdSensorlibcom.jrdcom.fmliblibcom.android.htmlviewerlibcom.android.emailfilesdeviceNamelibdatabasesEmailProvider.dbEmailProviderBody.dbcacheshared_prefsAndroidMail.Main.xmlcom.modoohut.dialershared_prefscallstate.xmlliblibdatabasesqsb-history.dbshared_prefsSearchSettings.xmlcom.android.providers.drmliblibapp_sslcachedatabasesdownloads.dbcom.android.defcontainerliblibshared_prefsContactsUpgradeReceiver.xmldatabasescontacts2.dbcom.android.certinstallerlibcom.android.cameraliblibshared_prefsCalendarUpgradeReceiver.xmldatabasescalendar.dbcom.broadcom.bt.app.systemliblibliblibcom.android.vendingapp_sslcachemarket.android.com.443app_widgetscachemainimageslibapp_carrier_billingdatabasessuggestions.dblocalappstate.dblibrary.dbshared_prefsbilling_preferences.xmlvending_preferences.xmlfinsky.xmluk.co.nickfines.RealCalclibcom.james.SmartNotepadcachewebviewCache65a5997ca3cfc191a36fe2f9cb3dd8564671acecdb290e45libdatabasessmart_notepad.dbwebviewCache.dbwebview.dbshared_prefscom.google.android.youtubecachefilesDATA_Preferencesdatabasesgoogle_analytics.dblibshared_prefsyoutube.xmlcom.android.setupwizardlibshared_prefs_has_set_default_values.xmllibdatabasessimple_notepad.dbcom.google.android.locationfilesDATA_Preferenceslibdatabasesuploads.dblibcom.android.vending.updaterliblibcom.aide.uilibcom.handcent.nextsmsliblibmms2gif.solibhccommon.sodatabaseshcsysdbcom.google.android.gsffileslibapp_sslcachemtalk.google.com.5228databasesgservices.dbgooglesettings.dbsubscribedfeeds.dbtalk.dbgls.dbshared_prefsEventLogService.xmlupdate.xmlCheckinService.xmlliborg.androidideas.taskbombfileslibdatabasesdatacom.google.android.apps.mapsdatabasesLayerInfofilesnlp_paramscp_stateDATA_Preferenceslibcachenlp_devicesnlp_GlsPlatformKeymodelslru.cacheselectorslru.cachemacsnlp_statecom.elgubbo.a2sdGUIlibcom.google.android.feedbackliblibapp_sslcacheapp_sslcachelibliblibjni_pckeyboard.solibcom.datalinkswitchlibcom.smartwho.SmartFileManagercachewebviewCache2278d158a3cfc191a36fe2f9cb3dd85627fa942fe2afc4b465a5997cc2b4009d4671acec31e1966650e005f1c96ce860db290e458e2a3effshared_prefsdatabaseswebviewCache.dbwebview.dbcom.smartwho.SmartFileManagerlibcom.nemustech.reginadatabasesregina_launcher.dbliblibtflua.solibtfapps.soshared_prefsReginaPref.xmllibjackpal.androidtermshared_prefsliblibjackpal-androidterm3.soccc71.pmwlibcom.dolphin.browserapp_iconscachewebviewCache526249c7b1d31f616a1c37b79b64b3ed6aae60f78ddcde2f4a279ba6e239f19bdatabaseswebviewCache.dbwebview.dbbookmark.dbshared_prefspromote_service_config.xmlupdate_service_config.xmllocalConfig.xmlfilesapp_geolocationlibapp_databasesapp_appcacheApplicationCache.dbapp_pluginscom.qualcomm.wiperliblibwiperjni.sonetgenius.bizcallibcom.android.server.vpnliblocalbscidrm.dbtmpmverproxy.fifomiscdhcpdhcpcd-wlan0.leasednsmasq.leaseswifibcm_supp.confsocketssystemkeysAppsOnSD.sksvpnprofileskeystorebluetoothbluetoothdappcom.aide.ui-1.apkcom.james.SmartNotepad-1.apkcom.android.vending-1.apknetgenius.bizcal-1.apkcom.zakus.wifiprofiles-1.apkcom.modoohut.dialer-1.apkcom.handcent.nextsms-1.apkcom.elgubbo.a2sdGUI-1.apkcom.datalinkswitch-1.apkccc71.pmw-1.apkPicFolder.apkDroid+Lingo.apkdontpanicdalvik-cacheradioqmux_connect_socketbackupprocessedpendingjournal22365.tmppropertypersist.service.adb.enablepersist.sys.timezonepersist.sys.extra_volumepersist.usb.onbootpersist.radio.nitz_plmnpersist.radio.nitz_long_ons_0systemthrottletemp1069211229registered_servicesshared_prefslog_files.xmlusagestatsusage-20120902usage-20120901entropy.dataccounts.dbsyncaccounts.xmlstatus.binpending.binstats.binwallpaper_info.xmldropboxevent_data@1346593493718.txtevent_data@1346550193037.txtevent_log@1346597094444.txtevent_data@1346559194634.txtevent_data@1346569995985.txtSYSTEM_BOOT@1346568127198.txtSYSTEM_BOOT@1346541185928.txtevent_data@1346600695632.txtevent_data@1346548392927.txtevent_data@1346557394001.txtevent_data@1346566395635.txtevent_data@1346575397679.txtSYSTEM_BOOT@1346604053381.txtevent_data@1346582600498.txtevent_data@1346591693575.txtevent_data@1346604493300.txtevent_data@1346546592718.txtSYSTEM_BOOT@1346585620624.txtevent_data@1346555593886.txtevent_data@1346568195895.txtevent_log@1346604493291.txtevent_data@1346564595063.txtSYSTEM_BOOT@1346605724940.txtevent_log@1346568195883.txtSYSTEM_BOOT@1346602681936.txtSYSTEM_BOOT@1346603486178.txtevent_data@1346580799894.txtevent_data@1346586201651.txtSYSTEM_BOOT@1346589879695.txtevent_data@1346595293829.txtevent_data@1346544792613.txtevent_log@1346586201642.txtevent_data@1346584401078.txtevent_data@1346553793796.txtevent_data@1346573596797.txtevent_data@1346562794931.txtevent_data@1346588001717.txtevent_data@1346598894933.txtevent_data@1346589892854.txtevent_data@1346541191753.txtevent_log@1346589892754.txtevent_data@1346542992487.txtevent_data@1346551993634.txtevent_log@1346542992481.txtevent_data@1346560994758.txtevent_data@1346571796681.txtSYSTEM_BOOT@1346596315376.txtevent_data@1346578998157.txtevent_data@1346577197780.txtevent_log@1346541191657.txtevent_data@1346602692110.txtevent_data@1346597094462.txtevent_log@1346602692028.txtSYSTEM_BOOT@1346607125673.txtevent_log@1346607134024.txtevent_data@1346607134083.txtevent_data@1346608934615.txtSYSTEM_BOOT@1346609493779.txtappwidgets.xmlbatterystats.binpackages.xmlpackages.listlost+found
    [B]Backing up datadata...[/B]
    JRD_custresappApplicationsProvider-res.apkCalendarProvider-res.apkCamera-res.apkContactsProvider-res.apkDownloadProvider-res.apkDrmProvider-res.apkEmail-res.apkHTMLViewer-res.apkJrdFmRadio-res.apkJrdSensor-res.apkMediaProvider-res.apkOPP-res.apkPBAP-res.apkPackageInstaller-res.apkPhone-res.apkSettings-res.apkSettingsProvider-res.apkSoundRecorder-res.apkStk-res.apkTelephonyProvider-res.apkVoiceDialer-res.apkVpnServices-res.apkaudioNotificationsCup.oggDrop.oggFlute.oggGenial.oggLighter.oggResonance.oggSet.oggShimmer.oggSomewhere.oggTerminate.oggVintage.oggWood.oggreceive_message.oggsend_message.oggwarning.oggRingtonesBeeper.oggBuzzer.oggEase.oggFarmstead.oggReflection.oggSign.oggalarmsAlarm.oggClick.oggPendulum.oggTwist.ogguiEffect_Tick.oggKeypressDelete.oggKeypressReturn.oggKeypressSpacebar.oggKeypressStandard.oggLock.oggLowBattery.oggUnlock.oggVideoRecord.oggcamera_click.oggfontsClockopia.ttfDroidSans-Bold.ttfDroidSans.ttfDroidSansArabic.ttfDroidSansFallback.ttfDroidSansHebrew.ttfDroidSansMono.ttfDroidSansThai.ttfDroidSerif-Bold.ttfDroidSerif-BoldItalic.ttfDroidSerif-Italic.ttfDroidSerif-Regular.ttfTele-Grotesk-Fett.ttfTele-Grotesk-Norm.ttfastronau.ttfmediabootanimation.zipwlannvram.txtapns-conf.xmlappGoogleBackupTransport.apkGoogleCalendarSyncAdapter.apkGoogleContactsSyncAdapter.apkGoogleFeedback.apkGoogleMAPS_6.0.2.apkGooglePartnerSetup.apkGoogleServicesFramework.apkLatinImeTutorial.apkMarketUpdater.apkMediaUploader.apkNetworkLocation.apkSetupWizard.apkYouTube_v2.3.4.apkcom.android.vending.apkbuild.propcustpack.verframeworkJrdshared.apkframework-res.apkplmn-list.confusrkeylayoutisdm_KeypadLayout.kllost+foundBacking up .android_secure...
    [B]Backing up cache...[/B]
    recoverylast_logloglost+foundobj257
    [B]Backing up sd-ext...[/B]
    [B]Generating md5 sum...[/B]
    
    Backup complete!
    mtd: successfully wrote block at fffffd5800000000
    I:Set boot command ""
    4
    urcgin sins.

    I prepare this afternoon a CWM based on GB kernel/drivers then I send it to you so check PM I do not wanna share it for some reasons

    anyway download Android System Info from Market and tap on System--> Buildinfos and post Bootloader version

    do not play with rooting at this time: remember that there is a chance to cause a software damage by this ...
    yes usually you solve it by flashing again but I think it's not working for you ..just wait...wait...

    UPDATE



    it's made check your mail and use that recovery to backup OS tell me if this works if not it's very bad news

    how to flash

    firstly check fastboot interface by

    "fastboot devices"
    you get something like "?.....devices " if not tell me

    better look at the picture !

    after flashing to enter recovery do this to be very sure:
    -remove battery/ insert it back
    -press Power
    -when you hear buzz from phone quickly press VolUp+ Menu keep it pressed ~20-30 sec to be sure then release
    -CWM menu ...

    BINGO! Sorry my delay. This is my sister's phone and she's not available all time.

    Going into fastboot
    Using this method : blog.podtwo com/android/recovery/ClockworkMod%20Recovery%20for%20Alcatel%20ot908.html

    Aplying your recovery.img
    Code:
    C:\Program Files\Android\android-sdk\platform-tools>fastboot devices
    ?       fastboot
    
    C:\Program Files\Android\android-sdk\platform-tools>fastboot flash recovery recovery.img
    sending 'recovery' (4758 KB)...
    OKAY [  1.192s]
    writing 'recovery'...
    OKAY [  0.805s]
    finished. total time: 1.997s
    
    C:\Program Files\Android\android-sdk\platform-tools>fastboot reboot
    rebooting...
    
    finished. total time: 0.002s
    
    C:\Program Files\Android\android-sdk\platform-tools>adb reboot recovery
    * daemon not running. starting it now on port 5037 *
    * daemon started successfully *
    
    C:\Program Files\Android\android-sdk\platform-tools>

    Going into CWM
    -remove battery/ insert it back
    -press Power
    -when you hear buzz from phone quickly press VolUp+ Menu keep it pressed ~20-30 sec to be sure then release
    -CWM menu ..

    Sources for ruscalin to make a new GB custom version:
    http dl.dropbox com/u/9718407/alcatel-ot908/boot.img
    http dl.dropbox com/u/9718407/alcatel-ot908/custpack.yaffs2.img
    http dl.dropbox com/u/9718407/alcatel-ot908/system.yaffs2.img
    4
    update

    Move ROM 4.0

    - kernel patched (support ext part ) now you can use CWM to format sdcard
    -CWM v. 5.0.2.8 with support for ext4 part ( will format sd-ext as ext4 this is faster)
    -changed screen locker
    -some mods ( status bar )
    -removed Maps ( will be available soon a zip package to install all Gapps)

    download from post #1